Protein Info for b0888 in Escherichia coli BW25113

Name: trxB
Annotation: thioredoxin reductase, FAD/NAD(P)-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01292: thioredoxin-disulfide reductase" amino acids 8 to 314 (307 residues), 416.4 bits, see alignment E=2.4e-129 PF07992: Pyr_redox_2" amino acids 8 to 302 (295 residues), 183.8 bits, see alignment E=1.3e-57 PF13738: Pyr_redox_3" amino acids 70 to 286 (217 residues), 62.5 bits, see alignment E=1.1e-20 PF00070: Pyr_redox" amino acids 148 to 225 (78 residues), 62.2 bits, see alignment E=1.4e-20

Best Hits

Swiss-Prot: 100% identical to TRXB_ECOLI: Thioredoxin reductase (trxB) from Escherichia coli (strain K12)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 100% identity to eco:b0888)

MetaCyc: 100% identical to thioredoxin reductase (Escherichia coli K-12 substr. MG1655)
Thioredoxin-disulfide reductase. [EC: 1.8.1.9]

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9P4 at UniProt or InterPro

Protein Sequence (321 amino acids)

>b0888 thioredoxin reductase, FAD/NAD(P)-binding (NCBI) (Escherichia coli BW25113)
MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDL
TGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYL
GLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDG
FRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGL
FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSA
GTGCMAALDAERYLDGLADAK