Protein Info for b0874 in Escherichia coli BW25113

Name: ybjE
Annotation: putative surface protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details PF03956: Lys_export" amino acids 113 to 297 (185 residues), 200.2 bits, see alignment E=1.2e-63

Best Hits

Swiss-Prot: 100% identical to LYSO_ECOLI: Lysine exporter LysO (lysO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0874)

MetaCyc: 100% identical to L-lysine/thialysine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-401; TRANS-RXN-492

Predicted SEED Role

"FIG003145: Surface protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75826 at UniProt or InterPro

Protein Sequence (299 amino acids)

>b0874 putative surface protein (VIMSS) (Escherichia coli BW25113)
MFSGLLIILVPLIVGYLIPLRQQAALKVINQLLSWMVYLILFFMGISLAFLDNLASNLLA
ILHYSAVSITVILLCNIAALMWLERGLPWRNHHQQEKLPSRIAMALESLKLCGVVVIGFA
IGLSGLAFLQHATEASEYTLILLLFLVGIQLRNNGMTLKQIVLNRRGMIVAVVVVVSSLI
GGLINAFILDLPINTALAMASGFGWYSLSGILLTESFGPVIGSAAFFNDLARELIAIMLI
PGLIRRSRSTALGLCGATSMDFTLPVLQRTGGLDMVPAAIVHGFILSLLVPILIAFFSA