Protein Info for b0863 in Escherichia coli BW25113

Name: artI
Annotation: arginine transporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01096: lysine-arginine-ornithine-binding periplasmic protein
  • amino acids 2 to 241 (240 residues), 307.6 bits, E=3.4e-96
• PF00497: SBP_bac_3
  • amino acids 23 to 242 (220 residues), 229 bits, E=2.5e-72

Best Hits

Swiss-Prot: 100% identical to ARTI_ECOLI: Putative ABC transporter arginine-binding protein 2 (artI) from Escherichia coli (strain K12)

KEGG orthology group: K09997, arginine transport system substrate-binding protein (inferred from 100% identity to eco:b0863)

MetaCyc: 65% identical to L-arginine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, periplasmic arginine-binding protein ArtI" in subsystem Arginine and Ornithine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

See P30859 at UniProt or InterPro

Protein Sequence (243 amino acids)

>b0863 arginine transporter subunit (NCBI) (Escherichia coli BW25113)
MKKVLIAALIAGFSLSATAAETIRFATEASYPPFESIDANNQIVGFDVDLAQALCKEIDA
TCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQGKYTS
VDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAVVTE
WLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNTALEKVKKDGTYETIYNKW
FQK