Protein Info for b0862 in Escherichia coli BW25113

Name: artQ
Annotation: arginine transporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 44 to 68 (25 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 6 to 86 (81 residues), 45 bits, see alignment E=6.3e-16 PF00528: BPD_transp_1" amino acids 25 to 230 (206 residues), 61.6 bits, see alignment E=4.3e-21

Best Hits

Swiss-Prot: 100% identical to ARTQ_ECOLI: Arginine ABC transporter permease protein ArtQ (artQ) from Escherichia coli (strain K12)

KEGG orthology group: K09999, arginine transport system permease protein (inferred from 100% identity to eco:b0862)

MetaCyc: 100% identical to L-arginine ABC transporter membrane subunit ArtQ (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, permease protein ArtQ" in subsystem Arginine and Ornithine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AE34 at UniProt or InterPro

Protein Sequence (238 amino acids)

>b0862 arginine transporter subunit (NCBI) (Escherichia coli BW25113)
MNEFFPLASAAGMTVGLAVCALIVGLALAMFFAVWESAKWRPVAWAGSALVTILRGLPEI
LVVLFIYFGSSQLLLTLSDGFTINLGFVQIPVQMDIENFDVSPFLCGVIALSLLYAAYAS
QTLRGALKAVPVGQWESGQALGLSKSAIFFRLVMPQMWRHALPGLGNQWLVLLKDTALVS
LISVNDLMLQTKSIATRTQEPFTWYIVAAAIYLVITLLSQYILKRIDLRATRFERRPS