Protein Info for b0829 in Escherichia coli BW25113

Name: gsiA
Annotation: fused predicted peptide transport subunits of ABC superfamily: ATP-binding components (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 PF00005: ABC_tran" amino acids 33 to 197 (165 residues), 102.8 bits, see alignment E=1e-32 amino acids 341 to 491 (151 residues), 108 bits, see alignment E=2.4e-34 PF08352: oligo_HPY" amino acids 248 to 281 (34 residues), 33.8 bits, see alignment (E = 1.5e-11) amino acids 543 to 575 (33 residues), 34.9 bits, see alignment (E = 6.6e-12) PF13401: AAA_22" amino acids 353 to 519 (167 residues), 27.3 bits, see alignment E=1.7e-09

Best Hits

Swiss-Prot: 100% identical to GSIA_ECOLI: Glutathione import ATP-binding protein GsiA (gsiA) from Escherichia coli (strain K12)

KEGG orthology group: K13892, glutathione transport system ATP-binding protein (inferred from 100% identity to eco:b0829)

MetaCyc: 100% identical to glutathione ABC transporter ATP binding subunit GsiA (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD in protein degradation cluster"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75796 at UniProt or InterPro

Protein Sequence (623 amino acids)

>b0829 fused predicted peptide transport subunits of ABC superfamily: ATP-binding components (RefSeq) (Escherichia coli BW25113)
MPHSDELDAGNVLAVENLNIAFMQDQQKIAAVRNLSFSLQRGETLAIVGESGSGKSVTAL
ALMRLLEQAGGLVQCDKMLLQRRSREVIELSEQNAAQMRHVRGADMAMIFQEPMTSLNPV
FTVGEQIAESIRLHQNASREEAMVEAKRMLDQVRIPEAQTILSRYPHQLSGGMRQRVMIA
MALSCRPAVLIADEPTTALDVTIQAQILQLIKVLQKEMSMGVIFITHDMGVVAEIADRVL
VMYQGEAVETGTVEQIFHAPQHPYTRALLAAVPQLGAMKGLDYPRRFPLISLEHPAKQAP
PIEQKTVVDGEPVLRVRNLVTRFPLRSGLLNRVTREVHAVEKVSFDLWPGETLSLVGESG
SGKSTTGRALLRLVESQGGEIIFNGQRIDTLSPGKLQALRRDIQFIFQDPYASLDPRQTI
GDSIIEPLRVHGLLPGKDAAARVAWLLERVGLLPEHAWRYPHEFSGGQRQRICIARALAL
NPKVIIADEAVSALDVSIRGQIINLLLDLQRDFGIAYLFISHDMAVVERISHRVAVMYLG
QIVEIGPRRAVFENPQHPYTRKLLAAVPVAEPSRQRPQRVLLSDDLPSNIHLRGEEVAAV
SLQCVGPGHYVAQPQSEYAFMRR