Protein Info for b0820 in Escherichia coli BW25113

Name: ybiT
Annotation: fused predicted transporter subunits of ABC superfamily: ATP-binding components (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 PF00005: ABC_tran" amino acids 18 to 184 (167 residues), 71.3 bits, see alignment E=3.8e-23 amino acids 335 to 467 (133 residues), 89.4 bits, see alignment E=9.9e-29 PF12848: ABC_tran_Xtn" amino acids 224 to 309 (86 residues), 75.5 bits, see alignment E=8.4e-25

Best Hits

Swiss-Prot: 100% identical to YBIT_ECO57: Uncharacterized ABC transporter ATP-binding protein YbiT (ybiT) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b0820)

Predicted SEED Role

"Putative ATPase component of ABC transporter with duplicated ATPase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9U3 at UniProt or InterPro

Protein Sequence (530 amino acids)

>b0820 fused predicted transporter subunits of ABC superfamily: ATP-binding components (NCBI) (Escherichia coli BW25113)
MLVSSNVTMQFGSKPLFENISVKFGGGNRYGLIGANGSGKSTFMKILGGDLEPTLGNVSL
DPNERIGKLRQDQFAFEEFTVLDTVIMGHKELWEVKQERDRIYALPEMSEEDGYKVADLE
VKYGEMDGYSAEARAGELLLGVGIPVEQHYGPMSEVAPGWKLRVLLAQALFADPDILLLD
EPTNNLDIDTIRWLEQVLNERDSTMIIISHDRHFLNMVCTHMADLDYGELRVYPGNYDEY
MTAATQARERLLADNAKKKAQIAELQSFVSRFSANASKSRQATSRARQIDKIKLEEVKAS
SRQNPFIRFEQDKKLFRNALEVEGLTKGFDNGPLFKNLNLLLEVGEKLAVLGTNGVGKST
LLKTLVGDLQPDSGTVKWSENARIGYYAQDHEYEFENDLTVFEWMSQWKQEGDDEQAVRS
ILGRLLFSQDDIKKPAKVLSGGEKGRMLFGKLMMQKPNILIMDEPTNHLDMESIESLNMA
LELYQGTLIFVSHDREFVSSLATRILEITPERVIDFSGNYEDYLRSKGIE