Protein Info for b0795 in Escherichia coli BW25113

Name: ybhG
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF25917: BSH_RND" amino acids 43 to 234 (192 residues), 35.5 bits, see alignment E=1.5e-12 PF25881: HH_YBHG" amino acids 75 to 204 (130 residues), 224.4 bits, see alignment E=8.7e-71 PF25876: HH_MFP_RND" amino acids 110 to 169 (60 residues), 24.9 bits, see alignment E=3.9e-09 PF25954: Beta-barrel_RND_2" amino acids 240 to 328 (89 residues), 29 bits, see alignment E=2e-10

Best Hits

Swiss-Prot: 100% identical to YBHG_ECOLI: UPF0194 membrane protein YbhG (ybhG) from Escherichia coli (strain K12)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 100% identity to eco:b0795)

Predicted SEED Role

"Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75777 at UniProt or InterPro

Protein Sequence (332 amino acids)

>b0795 hypothetical protein (NCBI) (Escherichia coli BW25113)
MMKKPVVIGLAVVVLAAVVAGGYWWYQSRQDNGLTLYGNVDIRTVNLSFRVGGRVESLAV
DEGDAIKAGQVLGELDHKPYEIALMQAKAGVSVAQAQYDLMLAGYRNEEIAQAAAAVKQA
QAAYDYAQNFYNRQQGLWKSRTISANDLENARSSRDQAQATLKSAQDKLRQYRSGNREQD
IAQAKASLEQAQAQLAQAELNLQDSTLIAPSDGTLLTRAVEPGTVLNEGGTVFTVSLTRP
VWVRAYVDERNLDQAQPGRKVLLYTDGRPDKPYHGQIGFVSPTAEFTPKTVETPDLRTDL
VYRLRIVVTDADDALRQGMPVTVQFGDEAGHE