Protein Info for b0782 in Escherichia coli BW25113

Name: moaB
Annotation: molybdopterin biosynthesis protein B (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 TIGR02667: molybdenum cofactor biosynthesis protein B" amino acids 7 to 169 (163 residues), 275.5 bits, see alignment E=1.2e-86 TIGR00177: molybdenum cofactor synthesis domain" amino acids 12 to 153 (142 residues), 133 bits, see alignment E=8.3e-43 PF00994: MoCF_biosynth" amino acids 14 to 156 (143 residues), 108.2 bits, see alignment E=1.5e-35

Best Hits

Swiss-Prot: 100% identical to MOAB_ECO57: Molybdenum cofactor biosynthesis protein B (moaB) from Escherichia coli O157:H7

KEGG orthology group: K03638, molybdenum cofactor biosynthesis protein B (inferred from 100% identity to eco:b0782)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AEZ9 at UniProt or InterPro

Protein Sequence (170 amino acids)

>b0782 molybdopterin biosynthesis protein B (NCBI) (Escherichia coli BW25113)
MSQVSTEFIPTRIAILTVSNRRGEEDDTSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQ
VSAWIASDDVQVVLITGGTGLTEGDQAPEALLPLFDREVEGFGEVFRMLSFEEIGTSTLQ
SRAVAGVANKTLIFAMPGSTKACRTAWENIIAPQLDARTRPCNFHPHLKK