Protein Info for b0740 in Escherichia coli BW25113

Name: tolB
Annotation: translocation protein TolB precursor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 15 to 427 (413 residues), 521.2 bits, see alignment E=9.9e-161 PF04052: TolB_N" amino acids 24 to 121 (98 residues), 105.1 bits, see alignment E=6.4e-34 PF07676: PD40" amino acids 199 to 223 (25 residues), 24 bits, see alignment (E = 8.9e-09) amino acids 237 to 272 (36 residues), 36.1 bits, see alignment 1.4e-12 amino acids 281 to 315 (35 residues), 39.2 bits, see alignment 1.6e-13 amino acids 369 to 396 (28 residues), 17.6 bits, see alignment (E = 9.4e-07) PF00930: DPPIV_N" amino acids 249 to 352 (104 residues), 33.7 bits, see alignment E=5.3e-12

Best Hits

Swiss-Prot: 100% identical to TOLB_ECOLI: Tol-Pal system protein TolB (tolB) from Escherichia coli (strain K12)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to eco:b0740)

MetaCyc: 100% identical to Tol-Pal system periplasmic protein TolB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A855 at UniProt or InterPro

Protein Sequence (430 amino acids)

>b0740 translocation protein TolB precursor (NCBI) (Escherichia coli BW25113)
MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAA
DLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVD
TGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPY
ELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVA
SFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQ
NLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAK
QDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQ
VKFPAWSPYL