Protein Info for b0735 in Escherichia coli BW25113

Name: ybgE
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 97 signal peptide" amino acids 16 to 16 (1 residues), see Phobius details transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details TIGR02112: cyd operon protein YbgE" amino acids 5 to 97 (93 residues), 141.7 bits, see alignment E=4.5e-46 PF09600: Cyd_oper_YbgE" amino acids 17 to 94 (78 residues), 115.8 bits, see alignment E=4.6e-38

Best Hits

Swiss-Prot: 100% identical to YBGE_ECOLI: Uncharacterized protein YbgE (ybgE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0735)

Predicted SEED Role

"Cyd operon protein YbgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAV0 at UniProt or InterPro

Protein Sequence (97 amino acids)

>b0735 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MSKIIATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSELEIWHGLLLMWAVCA
GVIHGVGFRPQKVLWQGIFCPLLADIVLIVGLIFFFF