Protein Info for b0698 in Escherichia coli BW25113

Name: kdpA
Annotation: potassium-transporting ATPase subunit A (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 62 to 83 (22 residues), see Phobius details amino acids 99 to 110 (12 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details amino acids 526 to 549 (24 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 557 (557 residues), 1008.1 bits, see alignment E=5.4e-308 PF03814: KdpA" amino acids 11 to 556 (546 residues), 802.1 bits, see alignment E=9.8e-246

Best Hits

Swiss-Prot: 100% identical to KDPA_ECOBW: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to eco:b0698)

MetaCyc: 100% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P03959 at UniProt or InterPro

Protein Sequence (557 amino acids)

>b0698 potassium-transporting ATPase subunit A (NCBI) (Escherichia coli BW25113)
MAAQGFLLIATFLLVLMVLARPLGSGLARLINDIPLPGTTGVERVLFRALGVSDREMNWK
QYLCAILGLNMLGLAVLFFMLLGQHYLPLNPQQLPGLSWDLALNTAVSFVTNTNWQSYSG
ETTLSYFSQMAGLTVQNFLSAASGIAVIFALIRAFTRQSMSTLGNAWVDLLRITLWVLVP
VALLIALFFIQQGALQNFLPYQAVNTVEGAQQLLPMGPVASQEAIKMLGTNGGGFFNANS
SHPFENPTALTNFVQMLAIFLIPTALCFAFGEVMGDRRQGRMLLWAMSVIFVICVGVVMW
AEVQGNPHLLALGTDSSINMEGKESRFGVLVSSLFAVVTTAASCGAVIAMHDSFTALGGM
VPMWLMQIGEVVFGGVGSGLYGMMLFVLLAVFIAGLMIGRTPEYLGKKIDVREMKLTALA
ILVTPTLVLMGAALAMMTDAGRSAMLNPGPHGFSEVLYAVSSAANNNGSAFAGLSANSPF
WNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQAASSGTLPTHGPLFVGLLIGTVLLVGA
LTFIPALALGPVAEYLS