Protein Info for b0697 in Escherichia coli BW25113

Name: kdpB
Annotation: potassium-transporting ATPase subunit B (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 682 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 252 to 276 (25 residues), see Phobius details amino acids 576 to 597 (22 residues), see Phobius details amino acids 616 to 636 (21 residues), see Phobius details amino acids 655 to 677 (23 residues), see Phobius details TIGR01497: K+-transporting ATPase, B subunit" amino acids 2 to 677 (676 residues), 1285.1 bits, see alignment E=0 TIGR01494: HAD ATPase, P-type, family IC" amino acids 72 to 337 (266 residues), 128.5 bits, see alignment E=2.6e-41 amino acids 372 to 604 (233 residues), 166.2 bits, see alignment E=9.1e-53 PF00122: E1-E2_ATPase" amino acids 118 to 208 (91 residues), 71.4 bits, see alignment E=7.2e-24 PF00702: Hydrolase" amino acids 301 to 530 (230 residues), 104.8 bits, see alignment E=1.2e-33 PF08282: Hydrolase_3" amino acids 501 to 549 (49 residues), 21 bits, see alignment 3.8e-08

Best Hits

Swiss-Prot: 100% identical to KDPB_ECOBW: Potassium-transporting ATPase ATP-binding subunit (kdpB) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K01547, K+-transporting ATPase ATPase B chain [EC: 3.6.3.12] (inferred from 100% identity to ebw:BWG_0557)

MetaCyc: 100% identical to K+ transporting P-type ATPase subunit KdpB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P03960 at UniProt or InterPro

Protein Sequence (682 amino acids)

>b0697 potassium-transporting ATPase subunit B (NCBI) (Escherichia coli BW25113)
MSRKQLALFEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLLTTCISIAMASGAMPG
NALFSAAISGWLWITVLFANFAEALAEGRSKAQANSLKGVKKTAFARKLREPKYGAAADK
VPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGGDFASVTGGT
RILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALTILLIALTIVFLLATATLW
PFSAWGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSRMLGANVIATSGRAVEAAGD
VDVLLLDKTGTITLGNRQASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRF
NLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKV
DQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFAQLRKMGIKTVMITGDNRLTAAA
IAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTGDGTNDAPALAQADVAVAMNSGTQ
AAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLTTFSIANDVAKYFAIIPAAFAATYP
QLNALNIMCLHSPDSAILSAVIFNALIIVFLIPLALKGVSYKPLTASAMLRRNLWIYGLG
GLLVPFIGIKVIDLLLTVCGLV