Protein Info for b0678 in Escherichia coli BW25113

Name: nagB
Annotation: glucosamine-6-phosphate deaminase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00502: glucosamine-6-phosphate deaminase
  • amino acids 1 to 259 (259 residues), 478 bits, E=3.3e-148
• PF01182: Glucosamine_iso
  • amino acids 9 to 223 (215 residues), 80.5 bits, E=8.4e-27

Best Hits

Swiss-Prot: 100% identical to NAGB_ECO7I: Glucosamine-6-phosphate deaminase (nagB) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K02564, glucosamine-6-phosphate deaminase [EC: 3.5.99.6] (inferred from 100% identity to eco:b0678)

MetaCyc: 100% identical to glucosamine-6-phosphate deaminase (Escherichia coli K-12 substr. MG1655)
Glucosamine-6-phosphate deaminase. [EC: 3.5.99.6]

Predicted SEED Role

"Glucosamine-6-phosphate deaminase (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (6/6 steps found)
• N-acetylglucosamine degradation II (3/3 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• chitin derivatives degradation (4/8 steps found)
• chitin degradation I (archaea) (2/7 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.6

Sequence Analysis Tools

See P0A759 at UniProt or InterPro

Protein Sequence (266 amino acids)

>b0678 glucosamine-6-phosphate deaminase (NCBI) (Escherichia coli BW25113)
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQ
VSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQ
YEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQ
VPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCD
EPSTMELKVKTLRYFNELEAENIKGL