Protein Info for b0677 in Escherichia coli BW25113

Name: nagA
Annotation: N-acetylglucosamine-6-phosphate deacetylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR00221: N-acetylglucosamine-6-phosphate deacetylase" amino acids 1 to 377 (377 residues), 611.5 bits, see alignment E=2.7e-188 PF22643: NagA_N" amino acids 1 to 51 (51 residues), 85.9 bits, see alignment 1.7e-28 PF01979: Amidohydro_1" amino acids 50 to 379 (330 residues), 170.8 bits, see alignment E=5.1e-54

Best Hits

Swiss-Prot: 100% identical to NAGA_ECO57: N-acetylglucosamine-6-phosphate deacetylase (nagA) from Escherichia coli O157:H7

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 100% identity to eco:b0677)

MetaCyc: 100% identical to N-acetylglucosamine-6-phosphate deacetylase (Escherichia coli K-12 substr. MG1655)
N-acetylglucosamine-6-phosphate deacetylase. [EC: 3.5.1.25]

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AF18 at UniProt or InterPro

Protein Sequence (382 amino acids)

>b0677 N-acetylglucosamine-6-phosphate deacetylase (NCBI) (Escherichia coli BW25113)
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL
NGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAK
HPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEV
ISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEAD
IYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANL
TAFTPDFKITKTIVNGNEVVTQ