Protein Info for b0676 in Escherichia coli BW25113

Name: nagC
Annotation: DNA-binding transcriptional dual regulator, repressor of N-acetylglucosamine (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF01047: MarR" amino acids 25 to 63 (39 residues), 29 bits, see alignment 1.2e-10 PF00480: ROK" amino acids 89 to 392 (304 residues), 344.5 bits, see alignment E=8.9e-107

Best Hits

Swiss-Prot: 100% identical to NAGC_ECOLI: N-acetylglucosamine repressor (nagC) from Escherichia coli (strain K12)

KEGG orthology group: K02565, N-acetylglucosamine repressor (inferred from 100% identity to eco:b0676)

Predicted SEED Role

"N-acetylglucosamine-6P-responsive transcriptional repressor NagC, ROK family" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AF20 at UniProt or InterPro

Protein Sequence (406 amino acids)

>b0676 DNA-binding transcriptional dual regulator, repressor of N-acetylglucosamine (NCBI) (Escherichia coli BW25113)
MTPGGQAQIGNVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERG
LIKEVDQQASTGGRRAISIVTETRNFHAIGVRLGRHDATITLFDLSSKVLAEEHYPLPER
TQQTLEHALLNAIAQFIDSYQRKLRELIAISVILPGLVDPDSGKIHYMPHIQVENWGLVE
ALEERFKVTCFVGHDIRSLALAEHYFGASQDCEDSILVRVHRGTGAGIISNGRIFIGRNG
NVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLNLLKQGYQSRVPLDDCTIKTI
CKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITEADKVLLPAIESCIN
TQALKAFRTNLPVVRSELDHRSAIGAFALVKRAMLNGILLQHLLEN