Protein Info for b0650 in Escherichia coli BW25113

Name: hscC
Annotation: Hsp70 family chaperone Hsc62, binds to RpoD and inhibits transcription (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 PF00012: HSP70" amino acids 7 to 81 (75 residues), 57.8 bits, see alignment E=6.5e-20 amino acids 86 to 539 (454 residues), 330.1 bits, see alignment E=2.3e-102 PF06723: MreB_Mbl" amino acids 7 to 338 (332 residues), 45.5 bits, see alignment E=4.7e-16

Best Hits

Swiss-Prot: 100% identical to HSCC_ECOLI: Chaperone protein HscC (hscC) from Escherichia coli (strain K12)

KEGG orthology group: K04045, molecular chaperone HscC (inferred from 100% identity to eco:b0650)

Predicted SEED Role

"Chaperone protein DnaK" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77319 at UniProt or InterPro

Protein Sequence (556 amino acids)

>b0650 Hsp70 family chaperone Hsc62, binds to RpoD and inhibits transcription (NCBI) (Escherichia coli BW25113)
MDNAELAIGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISMDENNHILVGKPAVSR
RTSHPDKTAALFKRAMGSNTNWRLGSDTFNAPELSSLVLRSLKEDAEEFLQRPIKDVVIS
VPAYFSDEQRKHTRLAAELAGLNAVRLINEPTAAAMAYGLHTQQNTRSLVFDLGGGTFDV
TVLEYATPVIEVHASAGDNFLGGEDFTHMLVDEVLKRADVARTTLNESELAALYACVEAA
KCSNQSPLHIRWQYQEETRECEFYENELEDLWLPLLNRLRVPIEQALRDARLKPSQIDSL
VLVGGASQMPLVQRIAVRLFGKLPYQSYDPSTIVALGAAIQAACRLRSEDIEEVILTDIC
PYSLGVEVNRQGVSGIFSPIIERNTTVPVSRVETYSTMHPEQDSITVNVYQGENHKVKNN
ILVESFDVPLKKTGAYQSIDIRFSYDINGLLEVDVLLEDGSVKSRVINHSPVTLSAQQIE
ESRTRLSALKIYPRDMLINRTFKAKLEELWARALGDEREEIGRVITDFDAALQSNDMARV
DEVRRRASDYLAIEIP