Protein Info for b0627 in Escherichia coli BW25113

Name: tatE
Annotation: twin arginine translocase protein E (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02416: TatA_B_E
  • amino acids 4 to 52 (49 residues), 45.8 bits, E=1.4e-16
• TIGR01411: twin arginine-targeting protein translocase, TatA/E family
  • amino acids 4 to 47 (44 residues), 70.1 bits, E=4.4e-24

Best Hits

Swiss-Prot: 100% identical to TATE_ECOLI: Sec-independent protein translocase protein TatE (tatE) from Escherichia coli (strain K12)

KEGG orthology group: K03425, sec-independent protein translocase protein TatE (inferred from 100% identity to eco:b0627)

MetaCyc: 100% identical to twin arginine protein translocation system - TatE protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatE" in subsystem Twin-arginine translocation system

Sequence Analysis Tools

See P0A843 at UniProt or InterPro

Protein Sequence (67 amino acids)

>b0627 twin arginine translocase protein E (NCBI) (Escherichia coli BW25113)
MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMNDDDAAAKKGADVDLQA
EKLSHKE