Protein Info for b0608 in Escherichia coli BW25113

Name: ybdR
Annotation: predicted oxidoreductase, Zn-dependent and NAD(P)-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF08240: ADH_N" amino acids 25 to 153 (129 residues), 89.8 bits, see alignment E=1.3e-29 PF00107: ADH_zinc_N" amino acids 197 to 283 (87 residues), 40.9 bits, see alignment E=1.9e-14

Best Hits

Swiss-Prot: 100% identical to YBDR_ECOLI: Uncharacterized zinc-type alcohol dehydrogenase-like protein YbdR (ybdR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0608)

Predicted SEED Role

"Uncharacterized zinc-type alcohol dehydrogenase-like protein ybdR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77316 at UniProt or InterPro

Protein Sequence (412 amino acids)

>b0608 predicted oxidoreductase, Zn-dependent and NAD(P)-binding (NCBI) (Escherichia coli BW25113)
MKALTYHGPHHVQVENVPDPGVEQADDIILRITATAICGSDLHLYRGKIPQVKHGDIFGH
EFMGEVVETGKDVKNLQKGDRVVIPFVIACGDCFFCRLQQYAACENTNAGKGAALNKKQI
PAPAALFGYSHLYGGVPGGQAEYVRVPKGNVGPFKVPPLLSDDKALFLSDILPTAWQAAK
NAQIQQGSSVAVYGAGPVGLLTIACARLLGAEQIFVVDHHPYRLHFAADRYGAIPINFDE
DSDPAQSIIEQTAGHRGVDAVIDAVGFEAKGSTTETVLTNLKLEGSSGKALRQCIAAVRR
GGIVSVPGVYAGFIHGFLFGDAFDKGLSFKMGQTHVHAWLGELLPLIEKGLLKPEEIVTH
YMPFEEAARGYEIFEKREEECRKVILVPGAQSAEAAQKAVSGLVNAMPGGTI