Protein Info for b0569 in Escherichia coli BW25113

Name: nfrB
Annotation: bacteriophage N4 receptor, inner membrane subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 745 transmembrane" amino acids 15 to 42 (28 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 70 to 332 (263 residues), 121.8 bits, see alignment E=9.4e-39 PF13632: Glyco_trans_2_3" amino acids 165 to 382 (218 residues), 139.1 bits, see alignment E=3.5e-44 PF05157: MshEN" amino acids 542 to 628 (87 residues), 51.7 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 100% identical to NFRB_ECO57: Bacteriophage N4 adsorption protein B (nfrB) from Escherichia coli O157:H7

KEGG orthology group: K11740, bacteriophage N4 adsorption protein B (inferred from 100% identity to eco:b0569)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFA5 at UniProt or InterPro

Protein Sequence (745 amino acids)

>b0569 bacteriophage N4 receptor, inner membrane subunit (NCBI) (Escherichia coli BW25113)
MDWLLDVFATWLYGLKVIAITLAVIMFISGLDDFFIDVVYWVRRIKRKLSVYRRYPRMSY
RELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFVGTYPNDPDTQRDVDEV
CARFPNVHKVVCARPGPTSKADCLNNVLDAITQFERSANFAFAGFILHDAEDVISPMELR
LFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKDVPVREALAGQVPSAGVGT
CFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTEIFVRFPVVDEAKEREQRKF
LQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFKTHKWTSSLTLNYFLWRDRKG
AISNFVSFLAMLVMIQLLLLLAYESLWPDAWHFLSIFSGSAWLMTLLWLNFGLMVNRIVQ
RVIFVTGYYGLTQGLLSVLRLFWGNLINFMANWRALKQVLQHGDPRRVAWDKTTHDFPSV
TGDTRSLRPLGQILLENQVITEEQLDTALRNRVEGLRLGGSMLMQGLISAEQLAQALAEQ
NGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRLENDELIVGSEDGIDPVSLAALTRK
VGRKVRYVIVLRGQIVTGLRHWYARRRGHDPRAMLYNAVQHQWLTEQQAGEIWRQYVPHQ
FLFAEILTTLGHINRSAINVLLLRHERSSLPLGKFLVTEGVISQETLDRVLTIQRELQVS
MQSLLLKAGLNTEQVAQLESENEGE