Protein Info for b0565 in Escherichia coli BW25113

Name: ompT
Annotation: DLP12 prophage; outer membrane protease VII (outer membrane protein 3b) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01278: Omptin" amino acids 28 to 317 (290 residues), 432.8 bits, see alignment E=2.5e-134

Best Hits

Swiss-Prot: 100% identical to OMPT_ECOLI: Protease 7 (ompT) from Escherichia coli (strain K12)

KEGG orthology group: K01355, omptin [EC: 3.4.23.49] (inferred from 100% identity to eco:b0565)

MetaCyc: 100% identical to DLP12 prophage; omptin family outer membrane protease OmpT (Escherichia coli K-12 substr. MG1655)
Omptin. [EC: 3.4.23.49]

Predicted SEED Role

"Protease VII (Omptin) precursor (EC 3.4.23.49)" (EC 3.4.23.49)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P09169 at UniProt or InterPro

Protein Sequence (317 amino acids)

>b0565 DLP12 prophage; outer membrane protease VII (outer membrane protein 3b) (NCBI) (Escherichia coli BW25113)
MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVS
QLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESR
HPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDI
GSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVESSDNDEHYDPGKRIT
YRSKVKDQNYYSVAVNAGYYVTPNAKVYVEGAWNRVTNKKGNTSLYDHNNNTSDYSKNGA
GIENYNFITTAGLKYTF