Protein Info for b0550 in Escherichia coli BW25113

Name: rusA
Annotation: DLP12 prophage; endonuclease RUS (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF05866: RusA" amino acids 9 to 114 (106 residues), 84.3 bits, see alignment E=5.3e-28

Best Hits

Swiss-Prot: 100% identical to RUSA_ECOL6: Crossover junction endodeoxyribonuclease RusA (rusA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01160, crossover junction endodeoxyribonuclease RusA [EC: 3.1.22.4] (inferred from 100% identity to eco:b0550)

Predicted SEED Role

"Holliday junction resolvase / Crossover junction endodeoxyribonuclease rusA (EC 3.1.22.-)" (EC 3.1.22.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.22.4

Use Curated BLAST to search for 3.1.22.- or 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AG74 at UniProt or InterPro

Protein Sequence (120 amino acids)

>b0550 DLP12 prophage; endonuclease RUS (NCBI) (Escherichia coli BW25113)
MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIE
CHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMGNE