Protein Info for b0517 in Escherichia coli BW25113

Name: allD
Annotation: ureidoglycolate dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 226 to 245 (20 residues), see Phobius details TIGR03175: ureidoglycolate dehydrogenase" amino acids 1 to 349 (349 residues), 656.9 bits, see alignment E=3.6e-202 PF02615: Ldh_2" amino acids 3 to 331 (329 residues), 376.2 bits, see alignment E=7.1e-117

Best Hits

Swiss-Prot: 100% identical to ALLD_ECOLI: Ureidoglycolate dehydrogenase (NAD(+)) (allD) from Escherichia coli (strain K12)

KEGG orthology group: K00073, ureidoglycolate dehydrogenase [EC: 1.1.1.154] (inferred from 100% identity to eco:b0517)

MetaCyc: 100% identical to ureidoglycolate dehydrogenase (Escherichia coli K-12 substr. MG1655)
RXN0-7024 [EC: 1.1.1.350]

Predicted SEED Role

"Ureidoglycolate dehydrogenase (EC 1.1.1.154)" in subsystem Allantoin Utilization (EC 1.1.1.154)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.154 or 1.1.1.350

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77555 at UniProt or InterPro

Protein Sequence (349 amino acids)

>b0517 ureidoglycolate dehydrogenase (NCBI) (Escherichia coli BW25113)
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGG
TNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAI
SYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQ
AWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLL
GLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFN
QVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYNTSYETKNPFAQ