Protein Info for b0516 in Escherichia coli BW25113

Name: allC
Annotation: N-carbamoyl-L-amino acid amidohydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03176: allantoate amidohydrolase
  • amino acids 1 to 411 (411 residues), 766.4 bits, E=5.6e-235
• TIGR01879: amidase, hydantoinase/carbamoylase family
  • amino acids 7 to 407 (401 residues), 660.2 bits, E=1.1e-202
• PF04389: Peptidase_M28
  • amino acids 61 to 145 (85 residues), 21.6 bits, E=1.6e-08
• PF01546: Peptidase_M20
  • amino acids 79 to 405 (327 residues), 93.4 bits, E=1.9e-30

Best Hits

Swiss-Prot: 100% identical to ALLC_ECOLI: Allantoate amidohydrolase (allC) from Escherichia coli (strain K12)

KEGG orthology group: K02083, allantoate deiminase [EC: 3.5.3.9] (inferred from 100% identity to eco:b0516)

MetaCyc: 100% identical to allantoate amidohydrolase (Escherichia coli K-12 substr. MG1655)
Allantoate deiminase. [EC: 3.5.3.9]

Predicted SEED Role

"Allantoate amidohydrolase (EC 3.5.3.9)" in subsystem Allantoin Utilization (EC 3.5.3.9)

MetaCyc Pathways

• allantoin degradation IV (anaerobic) (8/9 steps found)
• allantoin degradation to glyoxylate II (5/5 steps found)
• allantoin degradation to glyoxylate III (5/5 steps found)
• allantoin degradation to ureidoglycolate II (ammonia producing) (4/4 steps found)
• superpathway of allantoin degradation in plants (6/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.9

Sequence Analysis Tools

See P77425 at UniProt or InterPro

Protein Sequence (411 amino acids)

>b0516 N-carbamoyl-L-amino acid amidohydrolase (NCBI) (Escherichia coli BW25113)
MITHFRQAIEETLPWLSSFGADPAGGMTRLLYSPEWLETQQQFKKRMAASGLETRFDEVG
NLYGRLNGTEYPQEVVLSGSHIDTVVNGGNLDGQFGALAAWLAIDWLKTQYGAPLRTVEV
VAMAEEEGSRFPYVFWGSKNIFGLANPDDVRNICDAKGNSFVDAMKACGFTLPNAPLTPR
QDIKAFVELHIEQGCVLESNGQSIGVVNAIVGQRRYTVTLNGESNHAGTTPMGYRRDTVY
AFSRICHQSVEKAKRMGDPLVLTFGKVEPRPNTVNVVPGKTTFTIDCRHTDAAVLRDFTQ
QLENDMRAICDEMDIGIDIDLWMDEEPVPMNKELVATLTELCEREKLNYRVMHSGAGHDA
QIFAPRVPTCMIFIPSINGISHNPAERTNITDLAEGVKTLALMLYQLAWQK