Protein Info for b0505 in Escherichia coli BW25113

Name: allA
Annotation: ureidoglycolate hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04115: Ureidogly_lyase
  • amino acids 2 to 154 (153 residues), 175.5 bits, E=3.4e-56

Best Hits

Swiss-Prot: 100% identical to ALLA_ECOLI: Ureidoglycolate lyase (allA) from Escherichia coli (strain K12)

KEGG orthology group: K01483, ureidoglycolate hydrolase [EC: 3.5.3.19] (inferred from 100% identity to eco:b0505)

MetaCyc: 100% identical to ureidoglycolate lyase (Escherichia coli K-12 substr. MG1655)
Ureidoglycolate lyase. [EC: 4.3.2.3]

Predicted SEED Role

"Ureidoglycolate hydrolase (EC 3.5.3.19)" in subsystem Allantoin Utilization (EC 3.5.3.19)

MetaCyc Pathways

• allantoin degradation to glyoxylate II (5/5 steps found)
• allantoin degradation to glyoxylate III (5/5 steps found)
• superpathway of allantoin degradation in plants (6/8 steps found)
• superpathway of purines degradation in plants (13/18 steps found)
• allantoin degradation to glyoxylate I (2/3 steps found)
• superpathway of allantoin degradation in yeast (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.19 or 4.3.2.3

Sequence Analysis Tools

See P77731 at UniProt or InterPro

Protein Sequence (160 amino acids)

>b0505 ureidoglycolate hydrolase (NCBI) (Escherichia coli BW25113)
MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVEILEQDCTLISINRAQ
PANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHR
NVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA