Protein Info for b0416 in Escherichia coli BW25113
Name: nusB
Annotation: transcription antitermination protein NusB (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to NUSB_ECO55: Transcription antitermination protein NusB (nusB) from Escherichia coli (strain 55989 / EAEC)
KEGG orthology group: K03625, N utilization substance protein B (inferred from 100% identity to eco:b0416)Predicted SEED Role
"Transcription termination protein NusB" in subsystem Transcription factors bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0A780 at UniProt or InterPro
Protein Sequence (139 amino acids)
>b0416 transcription antitermination protein NusB (NCBI) (Escherichia coli BW25113) MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLAGVATNTA YLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAINEAIELAKSFGAEDSH KFVNGVLDKAAPVIRPNKK