Protein Info for b0411 in Escherichia coli BW25113

Name: tsx
Annotation: nucleoside channel, receptor of phage T6 and colicin K (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03502: Channel_Tsx" amino acids 32 to 294 (263 residues), 283.6 bits, see alignment E=8.5e-89

Best Hits

Swiss-Prot: 100% identical to TSX_ECOLI: Nucleoside-specific channel-forming protein Tsx (tsx) from Escherichia coli (strain K12)

KEGG orthology group: K05517, nucleoside-specific channel-forming protein (inferred from 100% identity to eco:b0411)

MetaCyc: 100% identical to nucleoside-specific channel-forming protein Tsx (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-468

Predicted SEED Role

"Nucleoside-specific channel-forming protein Tsx precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A927 at UniProt or InterPro

Protein Sequence (294 amino acids)

>b0411 nucleoside channel, receptor of phage T6 and colicin K (NCBI) (Escherichia coli BW25113)
MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLE
YEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGP
FKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANEN
EWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSH
ILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF