Protein Info for b0396 in Escherichia coli BW25113

Name: araJ
Annotation: involved in either transport or processing of arabinose polymers (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 227 to 253 (27 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 330 (323 residues), 144 bits, see alignment E=5.6e-46 PF00083: Sugar_tr" amino acids 41 to 177 (137 residues), 36.2 bits, see alignment E=3.6e-13

Best Hits

Swiss-Prot: 100% identical to ARAJ_ECOLI: Putative transporter AraJ (araJ) from Escherichia coli (strain K12)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 100% identity to eco:b0396)

Predicted SEED Role

"Protein AraJ precursor" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P23910 at UniProt or InterPro

Protein Sequence (394 amino acids)

>b0396 involved in either transport or processing of arabinose polymers (VIMSS) (Escherichia coli BW25113)
MKKVILSLALGTFGLGMAEFGIMGVLTELAHNVGISIPAAGHMISYYALGVVVGAPIIAL
FSSRYSLKHILLFLVALCVIGNAMFTLSSSYLMLAIGRLVSGFPHGAFFGVGAIVLSKII
KPGKVTAAVAGMVSGMTVANLLGIPLGTYLSQEFSWRYTFLLIAVFNIAVMASVYFWVPD
IRDEAKGNLREQFHFLRSPAPWLIFAATMFGNAGVFAWFSYVKPYMMFISGFSETAMTFI
MMLVGLGMVLGNMLSGRISGRYSPLRIAAVTDFIIVLALLMLFFCGGMKTTSLIFAFICC
AGLFALSAPLQILLLQNAKGGELLGAAGGQIAFNLGSAVGAYCGGMMLTLGLAYNYVALP
AALLSFAAMSSLLLYGRYKRQQAADTPVLAKPLG