Protein Info for b0384 in Escherichia coli BW25113

Name: psiF
Annotation: induced by phosphate starvation (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07769: PsiF_repeat" amino acids 27 to 59 (33 residues), 64.6 bits, see alignment E=2.8e-22 amino acids 71 to 103 (33 residues), 57 bits, see alignment E=6.6e-20

Best Hits

Swiss-Prot: 100% identical to PSIF_ECOLI: Phosphate starvation-inducible protein PsiF (psiF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0384)

Predicted SEED Role

"Phosphate starvation-inducible protein PsiF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFM4 at UniProt or InterPro

Protein Sequence (106 amino acids)

>b0384 induced by phosphate starvation (VIMSS) (Escherichia coli BW25113)
MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQALKGDARKTYMSDCLKN
SKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKKAA