Protein Info for b0340 in Escherichia coli BW25113

Name: cynS
Annotation: cyanate hydratase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 TIGR00673: cyanase" amino acids 1 to 156 (156 residues), 244.1 bits, see alignment E=2.5e-77 PF21291: CYNS_N" amino acids 11 to 79 (69 residues), 96.4 bits, see alignment E=8.1e-32 PF02560: Cyanate_lyase" amino acids 88 to 153 (66 residues), 107.6 bits, see alignment E=2.2e-35

Best Hits

Swiss-Prot: 100% identical to CYNS_ECOLI: Cyanate hydratase (cynS) from Escherichia coli (strain K12)

KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 100% identity to eco:b0340)

MetaCyc: 100% identical to cyanase (Escherichia coli K-12 substr. MG1655)
Cyanase. [EC: 4.2.1.104]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.104

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P00816 at UniProt or InterPro

Protein Sequence (156 amino acids)

>b0340 cyanate hydratase (NCBI) (Escherichia coli BW25113)
MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARL
VGAKLDLDEDSILLLQMIPLRGCIDDRIPTDPTMYRFYEMLQVYGTTLKALVHEKFGDGI
ISAINFKLDVKKVADPEGGERAVITLDGKYLPTKPF