Protein Info for b0315 in Escherichia coli BW25113

Name: yahA
Annotation: predicted DNA-binding transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00196: GerE" amino acids 25 to 72 (48 residues), 30.5 bits, see alignment 2.3e-11 PF00563: EAL" amino acids 112 to 346 (235 residues), 206.2 bits, see alignment E=5.1e-65

Best Hits

Swiss-Prot: 100% identical to PDEL_ECOLI: Cyclic di-GMP phosphodiesterase PdeL (pdeL) from Escherichia coli (strain K12)

KEGG orthology group: K13244, c-di-GMP-specific phosphodiesterase [EC: 3.1.4.52] (inferred from 100% identity to eco:b0315)

MetaCyc: 100% identical to DNA-binding transcriptional regulator/c-di-GMP phosphodiesterase PdeL (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"FIG00638331: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.52

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P21514 at UniProt or InterPro

Protein Sequence (362 amino acids)

>b0315 predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113)
MNSCDFRVFLQEFGTTVHLSLPGSVSEKERLLLKLLMQGMSVTEISQYRNRSAKTISHQK
KQLFEKLGIQSDITFWRDIFFQYNPEIISATGSNSHRYINDNHYHHIVTPEAISLALENH
EFKPWIQPVFCAQTGVLTGCEVLVRWEHPQTGIIPPDQFIPLAESSGLIVIMTRQLMKQT
ADILMPVKHLLPDNFHIGINVSAGCFLAAGFEKECLNLVNKLGNDKIKLVLELTERNPIP
VTPEARAIFDSLHQHNITFALDDFGTGYATYRYLQAFPVDFIKIDKSFVQMASVDEISGH
IVDNIVELARKPGLSIVAEGVETQEQADLMIGKGVHFLQGYLYSPPVPGNKFISEWVMKA
GG