Protein Info for b0286 in Escherichia coli BW25113

Name: yagT
Annotation: predicted xanthine dehydrogenase, 2Fe-2S subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00111: Fer2" amino acids 66 to 113 (48 residues), 42.3 bits, see alignment 9e-15 PF01799: Fer2_2" amino acids 133 to 221 (89 residues), 101.3 bits, see alignment E=3.8e-33

Best Hits

Swiss-Prot: 100% identical to PAOA_ECOLI: Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA (paoA) from Escherichia coli (strain K12)

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 100% identity to eco:b0286)

MetaCyc: 100% identical to aldehyde dehydrogenase, Fe-S subunit (Escherichia coli K-12 substr. MG1655)
Carboxylate reductase. [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77165 at UniProt or InterPro

Protein Sequence (229 amino acids)

>b0286 predicted xanthine dehydrogenase, 2Fe-2S subunit (NCBI) (Escherichia coli BW25113)
MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAATAVVYPHSTLAASVPAATPAPEI
MPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACL
TLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGI
PSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGEIKS