Protein Info for b0223 in Escherichia coli BW25113

Name: yafJ
Annotation: predicted amidotransfease (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF13230: GATase_4" amino acids 1 to 252 (252 residues), 382.6 bits, see alignment E=3.7e-119

Best Hits

Swiss-Prot: 100% identical to YAFJ_ECOLI: Putative glutamine amidotransferase YafJ (yafJ) from Escherichia coli (strain K12)

KEGG orthology group: K07008, glutamine amidotransferase (inferred from 100% identity to eco:b0223)

Predicted SEED Role

"Predicted glutamine amidotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q47147 at UniProt or InterPro

Protein Sequence (255 amino acids)

>b0223 predicted amidotransfease (NCBI) (Escherichia coli BW25113)
MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKGCRTFKDPQPSFNSPI
AKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWTYAHNGQLTGYKSLETG
NFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMAAVFKYIASLADELRQKGVFNMLLSDGR
YVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDVVTVIATQPLTGNETWQKI
MPGEWRLFCLGERVV