Protein Info for b0174 in Escherichia coli BW25113

Name: ispU
Annotation: undecaprenyl pyrophosphate synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 19 to 244 (226 residues), 357.3 bits, see alignment E=1.5e-111 PF01255: Prenyltransf" amino acids 24 to 244 (221 residues), 286.9 bits, see alignment E=5.1e-90

Best Hits

Swiss-Prot: 100% identical to UPPS_ECOL6: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (uppS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 100% identity to eco:b0174)

MetaCyc: 100% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P60472 at UniProt or InterPro

Protein Sequence (253 amino acids)

>b0174 undecaprenyl pyrophosphate synthase (NCBI) (Escherichia coli BW25113)
MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANN
GIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRL
QERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQH
VCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE
RRFGGTEPGDETA