Protein Info for b0157 in Escherichia coli BW25113

Name: yadS
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 62 to 79 (18 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details PF03458: Gly_transporter" amino acids 4 to 79 (76 residues), 86.1 bits, see alignment E=5.9e-29 amino acids 92 to 163 (72 residues), 76.4 bits, see alignment E=6.6e-26

Best Hits

Swiss-Prot: 100% identical to YADS_ECOL6: UPF0126 inner membrane protein YadS (yadS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to eco:b0157)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFP0 at UniProt or InterPro

Protein Sequence (207 amino acids)

>b0157 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGTIRDMALDHGPVFWVK
DPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGIGVNKAFNAEAGPLIAV
CMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHATAYYTFSVPLETASMMGM
VVTLLIRLAAIRWHLKLPTFALDENGR