Protein Info for b0121 in Escherichia coli BW25113

Name: speE
Annotation: spermidine synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF17284: Spermine_synt_N" amino acids 6 to 57 (52 residues), 74.4 bits, see alignment 5.3e-25 TIGR00417: spermidine synthase" amino acids 7 to 278 (272 residues), 415.5 bits, see alignment E=4.3e-129 PF01564: Spermine_synth" amino acids 60 to 239 (180 residues), 244.4 bits, see alignment E=6.6e-77

Best Hits

Swiss-Prot: 100% identical to SPEE_ECOLC: Polyamine aminopropyltransferase (speE) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to eco:b0121)

MetaCyc: 100% identical to spermidine synthase (Escherichia coli K-12 substr. MG1655)
Spermidine synthase. [EC: 2.5.1.16]; 2.5.1.- [EC: 2.5.1.16]

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P09158 at UniProt or InterPro

Protein Sequence (288 amino acids)

>b0121 spermidine synthase (NCBI) (Escherichia coli BW25113)
MAEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDE
FIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQY
LPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPIGPGESLFTSAFYEGCKR
CLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTFAWATDND
ALRHLSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQPS