Protein Info for b0120 in Escherichia coli BW25113

Name: speD
Annotation: S-adenosylmethionine decarboxylase proenzyme (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to SPED_ECO7I: S-adenosylmethionine decarboxylase proenzyme (speD) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 100% identity to eco:b0120)

MetaCyc: 100% identical to S-adenosylmethionine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1A" in subsystem Polyamine Metabolism (EC 4.1.1.50)

MetaCyc Pathways

superpathway of arginine and polyamine biosynthesis (16/17 steps found)
superpathway of polyamine biosynthesis I (7/8 steps found)
aminopropylcadaverine biosynthesis (3/3 steps found)
spermidine biosynthesis I (2/2 steps found)
spermine biosynthesis (1/2 steps found)
spermidine biosynthesis III (2/4 steps found)
superpathway of polyamine biosynthesis II (4/8 steps found)
L-methionine salvage cycle III (5/11 steps found)
L-methionine salvage cycle I (bacteria and plants) (5/12 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A7F6 at UniProt or InterPro

Protein Sequence (264 amino acids)

>b0120 S-adenosylmethionine decarboxylase proenzyme (NCBI) (Escherichia coli BW25113)
MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANRLTEILSETCSIIG
ANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPETVVAHLDKSHICVHTYP
ESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTIDYRVRGFTRDINGMKHF
IDHEINSIQNFMSDDMKALYDMVDVNVYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSE
RQEITAALWKEMREIYYGRNMPAV