Protein Info for b0086 in Escherichia coli BW25113

Name: murF
Annotation: UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 26 to 79 (54 residues), 32.9 bits, 1e-11
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 29 to 446 (418 residues), 476.1 bits, E=5e-147
• PF08245: Mur_ligase_M
  • amino acids 106 to 292 (187 residues), 180 bits, E=8.6e-57
• PF02875: Mur_ligase_C
  • amino acids 313 to 393 (81 residues), 52.5 bits, E=7.9e-18

Best Hits

Swiss-Prot: 100% identical to MURF_ECOLI: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (murF) from Escherichia coli (strain K12)

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 100% identity to eco:b0086)

MetaCyc: 100% identical to D-alanyl-D-alanine-adding enzyme (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase. [EC: 6.3.2.10]

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

See P11880 at UniProt or InterPro

Protein Sequence (452 amino acids)

>b0086 UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase (NCBI) (Escherichia coli BW25113)
MISVTLSQLTDILNGELQGADITLDAVTTDTRKLTPGCLFVALKGERFDAHDFADQAKAG
GAGALLVSRPLDIDLPQLIVKDTRLAFGELAAWVRQQVPARVVALTGSSGKTSVKEMTAA
ILSQCGNTLYTAGNLNNDIGVPMTLLRLTPEYDYAVIELGANHQGEIAWTVSLTRPEAAL
VNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADNNDWLNWQSVIGSRKVWRFS
PNAANSDFTATNIHVTSHGTEFTLQTPTGSVDVLLPLPGRHNIANALAAAALSMSVGATL
DAIKAGLANLKAVPGRLFPIQLAENQLLLDDSYNANVGSMTAAVQVLAEMPGYRVLVVGD
MAELGAESEACHVQVGEAAKAAGIDRVLSVGKQSHAISTASGVGEHFADKTALITRLKLL
IAEQQVITILVKGSRSAAMEEVVRALQENGTC