Protein Info for b0043 in Escherichia coli BW25113

Name: fixC
Annotation: predicted oxidoreductase with FAD/NAD(P)-binding domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF12831: FAD_oxidored" amino acids 7 to 157 (151 residues), 38.6 bits, see alignment E=4.7e-13 PF00890: FAD_binding_2" amino acids 7 to 41 (35 residues), 26.2 bits, see alignment 2.5e-09 PF01266: DAO" amino acids 7 to 54 (48 residues), 33.4 bits, see alignment 2e-11 amino acids 110 to 329 (220 residues), 34.6 bits, see alignment E=8.7e-12 PF01134: GIDA" amino acids 7 to 162 (156 residues), 32.6 bits, see alignment E=2.6e-11 PF01494: FAD_binding_3" amino acids 7 to 185 (179 residues), 48.9 bits, see alignment E=3.3e-16 PF13450: NAD_binding_8" amino acids 10 to 42 (33 residues), 31.6 bits, see alignment (E = 8.7e-11) PF21162: ETFQO_UQ-bd" amino acids 182 to 280 (99 residues), 35.2 bits, see alignment E=8.4e-12

Best Hits

Swiss-Prot: 100% identical to FIXC_ECOL6: Protein FixC (fixC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00313, electron transfer flavoprotein-quinone oxidoreductase [EC: 1.5.5.-] (inferred from 100% identity to eco:b0043)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 1.5.5.-

Use Curated BLAST to search for 1.5.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P68644 at UniProt or InterPro

Protein Sequence (428 amino acids)

>b0043 predicted oxidoreductase with FAD/NAD(P)-binding domain (NCBI) (Escherichia coli BW25113)
MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNVTGGRLYAHSLEHIIP
GFADSAPVERLITHEKLAFMTEKSAMTMDYCNGDETSPSQRSYSVLRSKFDAWLMEQAEE
AGAQLITGIRVDNLVQRDGKVVGVEADGDVIEAKTVILADGVNSILAEKLGMAKRVKPTD
VAVGVKELIELPKSVIEDRFQLQGNQGAACLFAGSPTDGLMGGGFLYTNENTLSLGLVCG
LHHLHDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYSAHVVPEAGINMLPELVGDGVLIA
GDAAGMCMNLGFTIRGMDLAIAAGEAAAKTVLSAMKSDDFSKQKLAEYRQHLESGPLRDM
RMYQKLPAFLDNPRMFSGYPELAVGVARDLFTIDGSAPELMRKKILRHGKKVGFINLIKD
GMKGVTVL