Protein Info for b0019 in Escherichia coli BW25113

Name: nhaA
Annotation: pH-dependent sodium/proton antiporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 207 to 238 (32 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 325 to 350 (26 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 6 to 380 (375 residues), 503 bits, see alignment E=2.3e-155 TIGR00773: Na+/H+ antiporter NhaA" amino acids 7 to 380 (374 residues), 659.8 bits, see alignment E=5.6e-203

Best Hits

Swiss-Prot: 100% identical to NHAA_ECOLI: Na(+)/H(+) antiporter NhaA (nhaA) from Escherichia coli (strain K12)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 100% identity to eco:b0019)

MetaCyc: 100% identical to Na+:H+ antiporter NhaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-129; TRANS-RXN-292

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P13738 at UniProt or InterPro

Protein Sequence (388 amino acids)

>b0019 pH-dependent sodium/proton antiporter (NCBI) (Escherichia coli BW25113)
MKHLHRFFSSDASGGIILIIAAILAMIMANSGATSGWYHDFLETPVQLRVGSLEINKNML
LWINDALMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGGMIVPALLYLAFNYADP
ITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIIDDLGAIIIIALFYTNDLS
MASLGVAAVAIAVLAVLNLCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLK
EKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTLDGLTSILPLGIIAGLLIGK
PLGISLFCWLALRLKLAHLPEGTTYQQIMVVGILCGIGFTMSIFIASLAFGSVDPELINW
AKLGILVGSISSAVIGYSWLRVRLRPSV