Protein Info for b0006 in Escherichia coli BW25113

Name: yaaA
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF03883: H2O2_YaaD" amino acids 1 to 243 (243 residues), 320.3 bits, see alignment E=3.9e-100

Best Hits

Swiss-Prot: 100% identical to YAAA_SHIFL: UPF0246 protein YaaA (yaaA) from Shigella flexneri

KEGG orthology group: K09861, hypothetical protein (inferred from 100% identity to eco:b0006)

Predicted SEED Role

"UPF0246 protein YaaA" in subsystem YaaA

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A8I3 at UniProt or InterPro

Protein Sequence (258 amino acids)

>b0006 hypothetical protein (NCBI) (Escherichia coli BW25113)
MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQISTLMRISDKLAGIN
AARFHDWQPDFTPANARQAILAFKGDVYTGLQAETFSEDDFDFAQQHLRMLSGLYGVLRP
LDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQGDNVVINLASDEYFKSVK
PKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIENRLTKPEQLTGFNSEGYFF
DEDSSSNGELVFKRYEQR