Protein Info for b0003 in Escherichia coli BW25113

Name: thrB
Annotation: homoserine kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00191: homoserine kinase
  • amino acids 2 to 309 (308 residues), 406.6 bits, E=2.5e-126
• PF00288: GHMP_kinases_N
  • amino acids 84 to 150 (67 residues), 59.1 bits, E=4.8e-20
• PF08544: GHMP_kinases_C
  • amino acids 211 to 285 (75 residues), 45.4 bits, E=8.8e-16

Best Hits

Swiss-Prot: 100% identical to KHSE_ECOLI: Homoserine kinase (thrB) from Escherichia coli (strain K12)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 100% identity to eco:b0003)

MetaCyc: 100% identical to homoserine kinase (Escherichia coli K-12 substr. MG1655)
Homoserine kinase. [EC: 2.7.1.39]; 2.7.1.- [EC: 2.7.1.39]

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

See P00547 at UniProt or InterPro

Protein Sequence (310 amino acids)

>b0003 homoserine kinase (NCBI) (Escherichia coli BW25113)
MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAETFSLNNLGRFADKLPSEP
RENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVVAALMAMNEHCGKPLND
TRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQQVPGFDEWLWVLAYPGI
KVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELAAKLMKDVIAEPYRERLLP
GFRQARQAVAEIGAVASGISGSGPTLFALCDKPETAQRVADWLGKNYLQNQEGFVHICRL
DTAGARVLEN