Protein Info for UW163_RS23610 in Ralstonia solanacearum UW163

Annotation: putative addiction module antidote protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 TIGR02684: probable addiction module antidote protein" amino acids 9 to 98 (90 residues), 124.8 bits, see alignment E=6.1e-41 PF21716: dnstrm_HI1420" amino acids 10 to 99 (90 residues), 95.4 bits, see alignment E=1.5e-31 PF01381: HTH_3" amino acids 53 to 96 (44 residues), 26.9 bits, see alignment E=4e-10

Best Hits

Swiss-Prot: 53% identical to Y1420_HAEIN: Uncharacterized protein HI_1420 (HI_1420) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 91% identity to rsl:RPSI07_mp0060)

Predicted SEED Role

"FIG045511: hypothetical antitoxin (to FIG022160: hypothetical toxin)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>UW163_RS23610 putative addiction module antidote protein (Ralstonia solanacearum UW163)
MTMAQRIIKTRPWDSAEHLRTEADMAAYLNACLEEAGDDPALITHALGVVARARGMTRLA
RETGITREGLYKALSEDGNPSFATMLKVIRALGIRLHAVPA