Protein Info for UW163_RS23220 in Ralstonia solanacearum UW163

Annotation: recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF13495: Phage_int_SAM_4" amino acids 38 to 124 (87 residues), 31.5 bits, see alignment E=2e-11 PF00589: Phage_integrase" amino acids 150 to 320 (171 residues), 138.2 bits, see alignment E=2.5e-44

Best Hits

Swiss-Prot: 91% identical to XERC2_RALSO: Tyrosine recombinase XerC 2 (xerC2) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: None (inferred from 91% identity to rso:RS05531)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>UW163_RS23220 recombinase XerC (Ralstonia solanacearum UW163)
MPRAGQRLKTRKPSAVKPAGPAKRAVDPLAHLVLTRYMEAHFEALLVTGYSADTVRARRI
SIRRFIVWCEERGIAQPADVTRAVLERYQRHLFYYRKPNGAPLTLGSQHGALAPLKTWFK
WLARENHILYNPASELDLPKLPKHLPRAILSVQEVEAILAEADPDTPYGLRDRAMLELLY
STGIRRMEVAGLALYDVDAMRRLVFVREGKGAKDRVVPIGERALAWLDRYLTEARPQLIV
GQQQALFVTDYGEAVSPEFVASHVKRYMEFAGIQKPGATHLLRHAMATHMLEAGADVRVL
QALLGHANLNTTEIYTHVSIEHLRAIHDATHPARLQREEAPTDATEALLDALGRDEG