Protein Info for UW163_RS22955 in Ralstonia solanacearum UW163

Annotation: crotonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 16 to 264 (249 residues), 172.6 bits, E=9.9e-55
• PF16113: ECH_2
  • amino acids 20 to 208 (189 residues), 86.7 bits, E=2.2e-28

Best Hits

Swiss-Prot: 79% identical to HCHL_PSEFL: Hydroxycinnamoyl-CoA hydratase-lyase from Pseudomonas fluorescens

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 97% identity to rsl:RPSI07_mp0178)

MetaCyc: 61% identical to feruloyl-CoA hydratase/lyase (Sphingomonas sp. SYK6)
4.1.2.41-RXN [EC: 4.1.2.61]; 4.1.2.61 [EC: 4.1.2.61]

Predicted SEED Role

"Probable FERULIC acid hydratase protein" in subsystem Phenylpropanoid compound degradation

MetaCyc Pathways

• oleate β-oxidation (31/35 steps found)
• adipate degradation (5/5 steps found)
• superpathway of phenylethylamine degradation (9/11 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• ferulate degradation (3/3 steps found)
• phenylacetate degradation I (aerobic) (7/9 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• adipate biosynthesis (4/5 steps found)
• 3-phenylpropanoate degradation (7/10 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (5/9 steps found)
• valproate β-oxidation (5/9 steps found)
• 4-coumarate degradation (aerobic) (2/5 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• capsaicin biosynthesis (3/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• 4-coumarate degradation (anaerobic) (1/6 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.1.2.61 or 4.2.1.17

Protein Sequence (277 amino acids)

>UW163_RS22955 crotonase (Ralstonia solanacearum UW163)
MATYAGRWSTVEVDVEDGIAWVTLNRPDKRNAMSPTLNREMIDVLETLELDADAQVLVLT
GAGESWSAGMDLKEYFRETDGQPEITQERIRRDCSQWQWKLLRFYSKPTIAMVNGWCFGG
AFSPLVACDLAIAADDAVFGLSEINWGIPPGNLVSKAVADTMGHRAALYYIMTGETFTGR
EAAEMGLVNWSVPRARLRQTVTELAAKLLAKNPVVLRFAKHGFKRCRELSWEQNEDYLYA
KVDQSNHRDPEKGRQHGLKQFLDDKTIKPGLQTYKRA