Protein Info for UW163_RS22835 in Ralstonia solanacearum UW163

Annotation: glycogen synthase GlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 4 to 478 (475 residues), 495.3 bits, see alignment E=8.8e-153 PF08323: Glyco_transf_5" amino acids 4 to 236 (233 residues), 221.9 bits, see alignment E=2.1e-69 PF13439: Glyco_transf_4" amino acids 19 to 224 (206 residues), 29.8 bits, see alignment E=1.2e-10 PF00534: Glycos_transf_1" amino acids 297 to 442 (146 residues), 58.7 bits, see alignment E=1.1e-19 PF13692: Glyco_trans_1_4" amino acids 300 to 442 (143 residues), 43.5 bits, see alignment E=8.3e-15

Best Hits

Swiss-Prot: 86% identical to GLGA_RALSO: Glycogen synthase (glgA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 86% identity to rso:RSp0242)

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>UW163_RS22835 glycogen synthase GlgA (Ralstonia solanacearum UW163)
MSLNVLFVASEAVPLAKTGGLGDMVGACAGALQRAGLRVTVMLPGYPAARAQLRDARVAC
ALPDLPGGPAWILLGTMPDTGVPVLLFDAPALFERPGNPYLDACGEPYADNALRFAAFSH
AAARVAGGVPGLPEFDIVQAHDWHAALVPLLVKRAGLPVRTVLTVHNLAFQGNFPLAVAH
EIGVPAEAAREAECFGRFSFLKAGLVSADRITTVSRTYGREILTDTFGYGMQDVLRARRH
DLVAILNGIDNAVWNPSKDAYLRQPFFAADLSGKHTAKRQLQTLLCLPKDAHAPLLALGS
RLTHQKMADVALQTLPQLLEAHPRLQVAVLGCGERRYESGMAALAARYPSRMAAMIGYTE
RNAHMLHAGADLLLHGSRFEPCGLTPLYAMRYGTVPVASRVGGLVDTITDRGSPEAALRG
ATGFLFDGESPEAMMRAVEHALRVFAQPRAWRILQYNGMTTDFGWSQPAREYLALYRALV
PRATPMPHLQHWPVPSAQPQLALPARRRRSTALSGAARAHAVARAASREKIRA