Protein Info for UW163_RS22765 in Ralstonia solanacearum UW163

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 166 to 187 (22 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details PF13426: PAS_9" amino acids 20 to 108 (89 residues), 41.8 bits, see alignment E=3.5e-14 TIGR00229: PAS domain S-box protein" amino acids 21 to 113 (93 residues), 47.6 bits, see alignment E=9e-17 PF00989: PAS" amino acids 24 to 105 (82 residues), 35.7 bits, see alignment E=2.4e-12 PF08447: PAS_3" amino acids 30 to 109 (80 residues), 55.8 bits, see alignment E=1.4e-18 PF00672: HAMP" amino acids 225 to 275 (51 residues), 47.5 bits, see alignment 5.3e-16 PF00015: MCPsignal" amino acids 340 to 496 (157 residues), 169.2 bits, see alignment E=2.3e-53

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 94% identity to rsl:RPSI07_mp0221)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>UW163_RS22765 methyl-accepting chemotaxis protein (Ralstonia solanacearum UW163)
MRNNLPVTDTETTLAPSDYLISRTDPAGRIVFANPAFVRISGFTEAELLGAPHNVVRHPD
MPEAAFADLWATLRSGLPWRGLVKNRRKDGGFYWVQANVTPVFQDGAIAGYTSVRSMATP
AQIARAGRAYAAVRAGDRSYAVRAGRILRTGWRRLFNLFRFDSLRFRVIGLQSLIAVAIL
IGTLWAHLALEAADLRGTPWLVLSRDWLWLTGVGCAGLATLSGVLLARTLIGPLEQAAAL
AARLAAGDLTSTLEARGNDEIGDVVRAMGTMRASLWSIVRGIQDSAANVAHSTLQISAGN
RDLSARTEQQAAALQETASSMEQLTSMVARNADHAREASTLAEQASSIATDGGQVVQRVV
DTMGAIRGSSQRVTDIIATIESIAFQTNILALNAAVEAARAGEEGRGFAVVAGEVRSLAQ
RSAQAAAQTKEIIQASDQSVRDGVALVQQAGATMEQIVASVRTVTRLMSEISASSREQSS
GIAQINASVSQLDGVTQQNATLVEEAAAAAAVLAGQSEALKRAVAVFRA