Protein Info for UW163_RS21695 in Ralstonia solanacearum UW163

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 100 to 126 (27 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details amino acids 413 to 431 (19 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 395 (358 residues), 172.3 bits, see alignment E=7.3e-55

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 97% identity to rsl:RPSI07_mp1384)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>UW163_RS21695 MFS transporter (Ralstonia solanacearum UW163)
MSINKETLPLAACGTSIGDKIRAAFAVGRMRWGMLALVFFATTLNYIDRAALGVLQPILA
KAMQWTAEDYANINFWFQVGYAIGFAAQGRFIDKVGVRRAFLLAVLLWSVAAGAHGLVSS
AAGFMVCRFFLGLTEAANYPACVKATRLWFPAGERAMATGIFNAGTNVGAMLTPLMLPLL
LQVWGWRAVFFVVGALGIVWVVFWLRNYFNPDAHPRVSAAELGYIREAVEAPAQRVPYRR
ILRMRGTWAFALAFALTAPVFWFYLYWLPPFLNQQYKLGISVTQIGLPLLVIYFTADIGS
IAGGALSSWLIGRGMAAVRARLVSMLICALCIVPVVFAVSADSLWEAVIAIALAVGAHQA
WTANIWSLVMDYTPKQVVSSVFGFGGMVGAIGGMFMTQLVGYVLTVTHNRYEVLFIMIPS
MYFIALAWLHFMAPRRVEQDA