Protein Info for UW163_RS21690 in Ralstonia solanacearum UW163

Annotation: TetR/AcrR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00440: TetR_N" amino acids 26 to 72 (47 residues), 53.5 bits, see alignment 1.7e-18 PF17938: TetR_C_29" amino acids 94 to 212 (119 residues), 155.9 bits, see alignment E=4.9e-50

Best Hits

Swiss-Prot: 36% identical to NICS_PSEPK: HTH-type transcriptional repressor NicS (nicS) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09017, TetR/AcrR family transcriptional regulator (inferred from 96% identity to rso:RS02063)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>UW163_RS21690 TetR/AcrR family transcriptional regulator (Ralstonia solanacearum UW163)
MAQPADTAAPVRPKRKNDPERTRADILAVATEEFAEQGFSGARVDTIAERTRTTKRMIYY
YFGSKEGLYLAVLEKKYEEIRAFESSLQLSDMDPEAAMRALIGATFDYEENHPEFVRLVA
VENIHNARHLAQSKTIANLNVTIVQTIQGLLERGRATGQFRAEVDALDLHLLITSFCFFR
VSNRATLETAFGQKLGTPKTRARHKQMLCDAVIRYLKD