Protein Info for UW163_RS21565 in Ralstonia solanacearum UW163

Annotation: spermidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 23 to 49 (27 residues), see Phobius details amino acids 55 to 79 (25 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details PF01564: Spermine_synth" amino acids 288 to 463 (176 residues), 113.1 bits, see alignment E=6e-37

Best Hits

Swiss-Prot: 97% identical to SPEE1_RALSO: Polyamine aminopropyltransferase 1 (speE1) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 97% identity to rso:RSp1306)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>UW163_RS21565 spermidine synthase (Ralstonia solanacearum UW163)
MPTPQPDAIDTSPPPLSPDRGNALLVLAVFVVASCGLAYELIAGALASYLLGDSILQFSS
IIGAYLFAMGIGSWVSRYVADEALLARFVDLELLVGLFGGISAAALFLLFALESAPFRLV
LYALVTVIGVLVGMEIPLVMRMLHRRQAKFSDLVSRVLTFDYLGALAVSLLFPLVLAPRL
GLVRTGFLFGLCNTAIAVWTLWHFRAELGLSARLRGAMAWRAGVVGAMLLAGFAASDRLT
HWSERALFGDEIIHAISSPYQRLVVTRWKDDLRLYINGNLQFSSRDEYRYHEALVLPALE
SVRGARRVLVLGGGDGLALRQILKYPQIEHVTLVDLDPRMTNLFSHAEALVALNQHAFSD
PRVTVVNADAGQWLQTAADMFDVAIVDFPDPSNFSIGKLYSVPFYRLLSRHVADTGLVVI
QATSPYFAPRSYWCVDATLKEAGYRTWPYHALVPSFGEWGFILAAPGRADFRPPTSYRVP
TRFLDADTTHQMFSFAPDMPRPQVEPNRLNNQSLVRYFEEDWHGVLR