Protein Info for UW163_RS21240 in Ralstonia solanacearum UW163

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details PF13564: DoxX_2" amino acids 23 to 128 (106 residues), 77.7 bits, see alignment E=3.2e-26

Best Hits

KEGG orthology group: None (inferred from 58% identity to bra:BRADO2406)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>UW163_RS21240 DoxX family protein (Ralstonia solanacearum UW163)
MSAMSTTAPSGPSKFLNAGLWAAQALICVGFVIIGGIKLFKPIPELAAMWPWTGQFPEAF
VRSLGVIDAAGGLGIFLPALLRIKPGLSVLAALGCVALQICAMVFHISRGEVAAIPVNIV
FLALAAFVLWGRRKLPVSAR